Quick Sweet Potato Brussel Sprout Hash - Delishum
30-MINUTE MEALS! Get the email series now
Royal Recipe

Quick Sweet Potato Brussels Sprout Hash

5 from 1 vote
1 Comments
Amelia Rose
By: Amelia RoseUpdated: Sep 20, 2026
This post may contain affiliate links. Please read our disclosure policy.

A bright, crispy skillet dish of sweet potatoes and Brussels sprouts seasoned with smoked paprika and garlic, ready for brunch or weeknight dinner in under 40 minutes.

Quick Sweet Potato Brussels Sprout Hash

This Quick Sweet Potato Brussels Sprout Hash is the kind of kitchen discovery that quietly became a weekday hero. I first put this combination together on a rushed Saturday morning when the pantry offered a lone sweet potato and a bag of Brussels sprouts. The result was a crunchy, caramelized medley with a smoky seasoning that made everyone at the table ask what smelled so good. It has the sweet-earth balance of roasted sweet potato and the nutty, slightly bitter char of halved Brussels sprouts. The texture is the highlight here: tender interior with crisp, browned edges that add a pleasing contrast to creamy avocado or runny egg yolk.

Because it cooks quickly and needs only a single skillet, this dish works for everything from a casual brunch to a simple weeknight main paired with greens. I like to keep the base flexible: you can add bacon for richness, turkey sausage for a lighter protein, tofu for a vegetarian boost, or simply top with an egg to make it a satisfying breakfast-for-dinner. The seasoning is straightforward but deliberate; smoked paprika brings depth and a faint sweetness while dried thyme adds an herbal backbone. Over time I've learned a few technique tricks that guarantee crisp edges and even cooking, which I share below so your first attempt turns out better than mine did the first time.

Why You'll Love This Recipe

  • This skillet dish is ready in about 40 minutes from start to finish, perfect for busy mornings or quick dinners.
  • It uses pantry staples and a few fresh vegetables that are widely available year-round, so you rarely need a special trip to the store.
  • Versatile protein options let you tailor it: bacon or sausage for a hearty meal, tofu for plant-based protein, or eggs for a classic brunch finish.
  • Single-pan cooking means easy cleanup and faster prep, while a cast iron skillet gives excellent caramelization for crisp edges.
  • Make-ahead friendly: roast the vegetables ahead and re-crisp in a skillet, or prepare all chopping the night before to cut morning time in half.
  • Gluten-free and naturally dairy-free in the base version, with simple swaps to meet vegetarian or vegan preferences.

From the first time my family tried it we all liked the way the sweet and savory notes played together. My partner declared it a winner because it felt substantial enough for dinner but bright enough for brunch, and guests have complimented the charred edges that give the dish its character. It’s become my fall-to dish when I want something fuss-free that still tastes thoughtful.

Ingredients

  • Sweet potatoes: Use one large sweet potato, diced into small, even 1/2" cubes so they cook through in the same time as the sprouts. Choose firm, orange-fleshed types for a naturally sweet flavor; brands don’t matter here, but avoid ones with soft spots.
  • Brussels sprouts: Two cups trimmed and halved gives good surface area for browning. Look for firm, compact sprouts with bright green leaves; loose or yellowing leaves indicate older produce.
  • Oil: One tablespoon of olive oil or avocado oil. Avocado oil tolerates high heat better for crisping, olive oil adds more flavor at medium heat.
  • Spices: Smoked paprika and garlic powder are the backbone for the savory-sweet profile; onion powder and dried thyme add depth. Keep salt and pepper to taste and adjust at the end.
  • Onion and bell pepper (optional): Half-cup each when used add sweetness, color, and a soft oniony base; dice small so they cook evenly with the vegetables.
  • Optional proteins: Chopped cooked bacon, turkey or breakfast sausage, tofu cubes, or eggs. These let you convert the vegetables into a more complete meal quickly.

Instructions

Step 1: Prep the vegetablesWash and dry the sweet potato then cut into small, uniform 1/2" dice. Trim the Brussels sprouts and slice them in half through the stem so they lay flat in the pan. If using onion and bell pepper, dice to roughly the same size as the potato pieces. Uniform pieces cook evenly and reduce the risk of underdone centers.Step 2: Heat the skilletPlace a large skillet over medium heat and add one tablespoon of oil. I prefer a seasoned cast iron pan for maximum crispiness because it holds heat well and creates an even crust. Let the oil shimmer but not smoke, about 1 to 2 minutes at medium heat.Step 3: Cook the sweet potatoesAdd the diced sweet potatoes in a single layer if possible. Cook undisturbed for 3 to 4 minutes to encourage browning, then stir occasionally for a total of 8 to 10 minutes until the edges begin to caramelize and the centers start to soften. If pieces brown too quickly, lower the heat slightly.Step 4: Add Brussels sprouts and aromaticsAdd the halved sprouts, diced onion, and bell pepper if using. Sprinkle in 1 teaspoon smoked paprika, 1 teaspoon garlic powder, 1/2 teaspoon onion powder, 1/2 teaspoon dried thyme, 1/2 teaspoon salt, and 1/4 teaspoon black pepper. Stir to coat and spread the vegetables back into a single layer where possible to maximize surface contact for better caramelization.Step 5: Crisp and cook throughAllow the mixture to cook, stirring only occasionally, for 10 to 12 minutes. Letting the pan sit between stirs lets the vegetables develop deep browning. If the pan seems dry, add a splash of oil. Use visual cues: golden-brown edges and tender centers indicate doneness. Avoid overcrowding the pan; work in batches for larger quantities.Step 6: Add proteins and finishIf using cooked bacon or sausage, fold it in for the last 4 to 5 minutes to warm through. For tofu, gently stir it in at the last 6 minutes so it crisps but does not fall apart. To cook eggs on top, make small wells in the hash, crack eggs into them, cover the skillet, and cook for 4 to 6 minutes until whites set and yolks reach desired doneness.Step 7: ServeRemove from heat and garnish with chopped fresh parsley or chives, avocado slices, and a few dashes of hot sauce if desired. Taste for seasoning and add more salt or pepper if needed. Serve immediately while edges are crisp.User provided content image 1

You Must Know

  • High heat and an even single layer encourage caramelization; avoid constant stirring during crisping stages to get those crunchy edges.
  • This base is naturally gluten-free and dairy-free; choose tofu or plant sausage to keep it vegetarian, and skip eggs or bacon for vegan results, using oil or vegan butter if you want richer flavor.
  • Keep the dice small and uniform to ensure sweet potatoes and sprouts finish about the same time; 1/2" pieces are ideal.
  • Leftovers reheat well in a skillet for 5 to 7 minutes to re-crisp; they also freeze for up to 3 months in airtight containers.

My favorite part of this preparation is the contrast: the sweet potato gives a tender buttery bite while the browned Brussels sprouts bring toasted notes that cut through the sweetness. Family members often argue over the crispiest bits. I’ve made this at holiday brunches when I needed something easy that could be multiplied without losing texture, and the method scales nicely as long as you roast or cook in batches to keep contact with the pan.

Storage Tips

Cool leftovers quickly and store them in airtight containers in the refrigerator for up to 4 days. To preserve crispness, keep any wet toppings like avocado or salsa separate and add them when serving. For freezing, spread cooked hash in a single layer on a baking sheet to flash-freeze for an hour, then transfer to freezer bags for up to 3 months. Reheat from frozen in a skillet over medium heat with a splash of oil until heated through and crisped, 8 to 12 minutes, or thaw overnight and reheat for 4 to 6 minutes.

Ingredient Substitutions

If you don’t have sweet potato, use Yukon gold or red potatoes for a milder flavor; increase cooking time slightly. Swap Brussels sprouts with baby bok choy quartered or broccoli florets for a different texture. Replace smoked paprika with regular paprika and add a pinch of ground cumin for an earthier profile. For a vegan protein boost, use firm tofu or a smoked tempeh cut into small cubes and pan-fry until golden before adding to the vegetables.

Serving Suggestions

Serve as a hearty brunch with runny fried or poached eggs and avocado slices, garnished with chopped parsley or chives. For dinner, pair it with a crisp green salad dressed in lemon vinaigrette or with grilled chicken for extra protein. It also makes an excellent filling for a warm wrap or a topping for toasted sourdough with a smear of labneh or vegan yogurt for tang. Drizzle with hot sauce or a smoky mustard for an added kick.

User provided content image 2

Cultural Background

This skillet preparation draws on simple, rustic American pan-fry traditions and seasonal Fall produce. Sweet potatoes and Brussels sprouts are staples in many northern hemisphere autumn and winter tables, and combining roasted root vegetables with cabbage-family greens is a long-standing home-cooking technique. The smoky paprika nods to smoky, hearth-cooked flavors popular in many cuisines, while the skillet method mirrors one-pan hash styles that evolved from peasant cooking where efficiency and flavor matter most.

Seasonal Adaptations

In late summer, swap the sweet potato for young Yukon gold potatoes and add fresh corn kernels in the last few minutes for sweetness. In winter, toss in roasted chestnuts or a spoonful of cranberry compote on the side for a holiday touch. Spring calls for lighter herbs, such as tarragon or mint, and swapping the Brussels sprouts for asparagus gives a fresh lift. Small changes in garnish and add-ins keep the dish relevant across seasons.

Meal Prep Tips

For streamlined mornings, chop vegetables the night before and store them in sealed containers in the refrigerator. Alternatively, roast the sweet potatoes and sprouts on a sheet tray at 425 degrees Fahrenheit for 20 minutes, cool, then finish in a skillet to re-crisp and add aromatics. Portion into microwave-safe containers for grab-and-go breakfasts and reheat in a skillet to restore texture. Store toppings like avocado and herbs separately to keep everything bright and fresh.

This hash is one of those dishes that rewards small adjustments: a tweak in spice, a protein swap, or a new garnish can make it feel new each time you cook it. It’s forgiving, fast, and friendly to a variety of diets when you choose your add-ins thoughtfully. Give it a try on a hectic morning or a relaxed weekend and make it your own.

Pro Tips

  • Cut vegetables into uniform 1/2" pieces so everything finishes at the same time and you avoid undercooked centers.

  • Use a cast iron skillet and let vegetables sit undisturbed between stirs to develop deep browning and crisp edges.

  • If pan becomes crowded, cook in two batches to ensure contact with the hot surface for caramelization.

  • For reheating leftovers, crisp them in a hot skillet rather than microwaving to restore texture.

This nourishing quick sweet potato brussels sprout hash recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Brunchrecipeone-panbreakfastdinnervegetarianhashsweet-potato
No ratings yet

Quick Sweet Potato Brussels Sprout Hash

This Quick Sweet Potato Brussels Sprout Hash recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 3 steaks
Quick Sweet Potato Brussels Sprout Hash
Prep:15 minutes
Cook:25 minutes
Rest Time:10 mins
Total:40 minutes

Ingredients

Hash

Optional Add-Ins

Optional Toppings

Instructions

1

Prep the Vegetables

Wash, dry, and dice the sweet potato into 1/2 inch cubes. Trim Brussels sprouts and slice in half through the stem so they sit flat. Dice onion and bell pepper if using.

2

Heat the Skillet

Warm 1 tablespoon oil in a large cast iron or heavy skillet over medium heat until shimmering but not smoking.

3

Cook the Sweet Potatoes

Add the sweet potato pieces in a single layer and cook 8 to 10 minutes, stirring occasionally, until edges brown and centers begin to soften.

4

Add Brussels Sprouts and Seasonings

Add halved Brussels sprouts, diced onion and bell pepper. Sprinkle spices and salt, stir to coat, and spread into a single layer for even browning.

5

Crisp and Cook Through

Cook 10 to 12 minutes, allowing the pan to sit between stirs so vegetables caramelize. Adjust heat to prevent burning and check for tender centers.

6

Add Optional Proteins

Fold in cooked bacon or sausage during the last 5 minutes, or add tofu to crisp for 6 minutes. For eggs, make wells, crack eggs in, cover, and cook until set.

7

Serve and Garnish

Remove from heat, garnish with herbs and avocado, add hot sauce if desired, and serve immediately while edges are crisp.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 150kcal | Carbohydrates: 30g | Protein:
3g | Fat: 6g | Saturated Fat: 2g |
Polyunsaturated Fat: 1g | Monounsaturated Fat:
2g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@delishum on social media!

Quick Sweet Potato Brussels Sprout Hash

Categories:

Quick Sweet Potato Brussels Sprout Hash

Did You Make This?

Leave a comment & rating below or tag @delishum on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Amelia!

Chef and recipe creator specializing in delicious Brunch cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.